PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pavir.9KG558300.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family HD-ZIP
Protein Properties Length: 842aa    MW: 92075 Da    PI: 6.2136
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pavir.9KG558300.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox57.62.2e-182886357
                         --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
             Homeobox  3 kRttftkeqleeLeelFeknrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57
                         k  ++t+eq+e+Le+l+  +++ps ++r++L +++    +++ +q+kvWFqNrR ++k+
  Pavir.9KG558300.1.p 28 KYVRYTPEQVEVLERLYIDCPKPSSSRRQQLLRECpilaNIEPKQIKVWFQNRRCRDKQ 86
                         5678****************************************************996 PP

2START1571.5e-491663742205
                          HHHHHHHHHHHHHHHC-TT-EEEEEXCCTTEEEEEEESSS.SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-SEEEEEEEECTT..E CS
                START   2 laeeaaqelvkkalaeepgWvkssesengdevlqkfeeskvdsgealrasgvvdmvlallveellddkeqWdetlakaetlevissg..g 89 
                          +aee+ +e+++ka+ ++  Wv+++ +++g++++ +++ s++++g a+ra+g+v  +++++ e+l d++  W +++++ e+      g  g
  Pavir.9KG558300.1.p 166 IAEETFTEFLSKATGTAIDWVQMPGMKPGPDSVGIVAISHGCRGVAARACGLVNLEPTKVIEILKDRP-SWFRDCRSLEVFTMFPAGngG 254
                          789999****************************************************7777777777.***********999999999* PP

                          EEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--....-TTSEE-EESSEEEEEEEECTCEEEEEEEE-EE--SS CS
                START  90 alqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppe...sssvvRaellpSgiliepksnghskvtwvehvdlkgr 175
                          +++l +++++a+++lvp Rdf+++Ry+ + ++g++v++++S++     p+   ++++vRae+lpSg+l++p+++g+s v++v+h dl++r
  Pavir.9KG558300.1.p 255 TIELVYMQMYAPTTLVPaRDFWTLRYTTTTEDGSLVVCERSLSGSGGGPNaasTHQLVRAEMLPSGYLVRPCEGGGSIVHIVDHLDLEAR 344
                          ********************************************9999999999************************************ PP

                          XXHHHHHHHHHHHHHHHHHHHHHHTXXXXX CS
                START 176 lphwllrslvksglaegaktwvatlqrqce 205
                          +++++lr+l++s+++ ++k+++ +l+++++
  Pavir.9KG558300.1.p 345 SVPEVLRPLYESSRVVAQKMTTVALRHLRQ 374
                          *********************999998765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007115.0942387IPR001356Homeobox domain
SMARTSM003895.3E-152591IPR001356Homeobox domain
CDDcd000861.26E-152888No hitNo description
SuperFamilySSF466891.03E-152889IPR009057Homeodomain-like
PfamPF000466.3E-162986IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.602.2E-173086IPR009057Homeodomain-like
CDDcd146863.77E-680119No hitNo description
PROSITE profilePS5084826.784156384IPR002913START domain
CDDcd088751.29E-73160376No hitNo description
Gene3DG3DSA:3.30.530.204.4E-20165348IPR023393START-like domain
SuperFamilySSF559614.53E-35165377No hitNo description
SMARTSM002348.1E-38165375IPR002913START domain
PfamPF018523.5E-47166374IPR002913START domain
PfamPF086705.6E-50698840IPR013978MEKHLA
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009855Biological Processdetermination of bilateral symmetry
GO:0009944Biological Processpolarity specification of adaxial/abaxial axis
GO:0009956Biological Processradial pattern formation
GO:0010014Biological Processmeristem initiation
GO:0010051Biological Processxylem and phloem pattern formation
GO:0010089Biological Processxylem development
GO:0030154Biological Processcell differentiation
GO:0005634Cellular Componentnucleus
GO:0008289Molecular Functionlipid binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 842 aa     Download sequence    Send to blast
MAAAVVAMPG GSSDSGGFDK VPGIDSGKYV RYTPEQVEVL ERLYIDCPKP SSSRRQQLLR  60
ECPILANIEP KQIKVWFQNR RCRDKQRKES SRLQAVNRKL TAMNKLLMEE NERLQKQVSQ  120
LVHENAHMRQ QLQNTSLAND TSCESNVTTP PNPTRDASNP SGLLSIAEET FTEFLSKATG  180
TAIDWVQMPG MKPGPDSVGI VAISHGCRGV AARACGLVNL EPTKVIEILK DRPSWFRDCR  240
SLEVFTMFPA GNGGTIELVY MQMYAPTTLV PARDFWTLRY TTTTEDGSLV VCERSLSGSG  300
GGPNAASTHQ LVRAEMLPSG YLVRPCEGGG SIVHIVDHLD LEARSVPEVL RPLYESSRVV  360
AQKMTTVALR HLRQIAQETS GEVVYALGRQ PAVLRTFSQR LSRGFNDAIS GFNDDGWSIM  420
GGDGIEDVIV ACNSTKKIRN SSSVGIAFGN PGGIICAKAS MLLQSVPPAV LVRFLREHRS  480
EWADYNIDAY LASSLKASAC SLPGLRPMRF SGGQMIMPLA HTVENEEILE VVRLEGQSLT  540
HDEALLSRDI HILQLCTGID EKSVGSSFQL VFAPIDDHFP DDTPLISSGF RVIPLDMKTD  600
GVSSSRTLDL ASSLDVGSAA SQASGDASPD DCNLRSVLTI AFQFPYEMHL QESVATMARQ  660
YVRSVVSAVQ RVSMAISPSQ SGLNAGQRML SGFPEAGTLA RWVCQSYHYH LGAELLNQSD  720
EAGEALLKML WHHPDAILCC SFKEKPMFTF ANKAGLDMLE TSLVALQDLT LDKIFDESGR  780
KALFSDISKL MEQGYVYLPS GVCMSGMGRH VSFDQAVAWK VLGEDSNVHC LALCFVNWSF  840
V*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Pvr.76350.0callus| leaf| root| stem
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankDQ2865260.0DQ286526.1 Zea mays rolled leaf 2 (rld2) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002468669.10.0hypothetical protein SORBIDRAFT_01g050000
SwissprotA2XBL90.0HOX10_ORYSI; Homeobox-leucine zipper protein HOX10
TrEMBLC5WMP70.0C5WMP7_SORBI; Putative uncharacterized protein Sb01g050000
STRINGSb01g050000.10.0(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP37438197
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60690.10.0HD-ZIP family protein